Protein Info for mRNA_2726 in Rhodosporidium toruloides IFO0880

Name: 11094
Annotation: K01725 cynS cyanate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00673: cyanase" amino acids 9 to 154 (146 residues), 162.5 bits, see alignment E=3.5e-52 PF02560: Cyanate_lyase" amino acids 89 to 155 (67 residues), 112.5 bits, see alignment E=3.3e-37

Best Hits

Swiss-Prot: 50% identical to CYNS_COPC7: Cyanate hydratase (CYN1) from Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)

KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 51% identity to scm:SCHCODRAFT_85234)

Predicted SEED Role

"Cyanate hydratase (EC 4.2.1.104)" in subsystem Cyanate hydrolysis (EC 4.2.1.104)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.104

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>mRNA_2726 K01725 cynS cyanate lyase (Rhodosporidium toruloides IFO0880)
MTSVVQSLADVNQQLFEAKKTKKLSFEQIAQRMGRDEVWVAALFYGQAKPTDDEVDKLID
VLGPWVDAKAMKRHFNPHFFPERGQLTPMPPTDPTLYRLYEVVGVYGYALKSVIHEKFGD
GIMSAINFSAKVDKVQKNGADTVRITYEGKWLPYDFHC