Protein Info for mRNA_2746 in Rhodosporidium toruloides IFO0880

Name: 11114
Annotation: K00859 coaE dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 2 to 180 (179 residues), 198.7 bits, E=3.3e-63
• TIGR00152: dephospho-CoA kinase
  • amino acids 3 to 189 (187 residues), 182.5 bits, E=3.7e-58

Best Hits

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 54% identity to cci:CC1G_06170)

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (7/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (4/5 steps found)
• coenzyme A biosynthesis I (prokaryotic) (3/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (3/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Protein Sequence (260 amino acids)

>mRNA_2746 K00859 coaE dephospho-CoA kinase (Rhodosporidium toruloides IFO0880)
MLVVGLTGGIASGKSTVTSLLKAHAIPVIDLDILARVAVEPESYALSALVRHFGDSILRS
DGTLNREALGSIVFNNEKERKVLNSIVHPAVRRLLAWELAKAWLRGEKICVVDAPLLIEA
GLWKLCGAIVVVYCSEILQLQRLRSRNNLSLTDAQARLSSQRPLSEKLDYADYVIDNSGP
IGDLQNQVDSVVAKLHKRAGWSWVVSWLVPPVGIVRAALRVGWRLWFQGVGKKKGRSTRG
EKKAEEIEMRDRRRRSSAAS