Protein Info for mRNA_2810 in Rhodosporidium toruloides IFO0880

Name: 11178
Annotation: K00026 MDH2 malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01772: malate dehydrogenase, NAD-dependent
  • amino acids 24 to 340 (317 residues), 426.1 bits, E=4.3e-132
• PF00056: Ldh_1_N
  • amino acids 24 to 167 (144 residues), 145.1 bits, E=1.6e-46
• PF02866: Ldh_1_C
  • amino acids 169 to 339 (171 residues), 148.8 bits, E=1.5e-47

Best Hits

Swiss-Prot: 61% identical to MDHM_SCHPO: Malate dehydrogenase, mitochondrial (MDH1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00026, malate dehydrogenase [EC: 1.1.1.37] (inferred from 67% identity to uma:UM00403.1)

MetaCyc: 51% identical to malate dehydrogenase (NAD) (Arabidopsis thaliana col)
Malate dehydrogenase. [EC: 1.1.1.37, 1.1.1.38]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (13/14 steps found)
• TCA cycle III (animals) (10/10 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• glyoxylate cycle (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• L-malate degradation II (1/1 steps found)
• chitin deacetylation (3/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• reductive TCA cycle I (7/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• L-carnitine degradation II (1/3 steps found)
• methylgallate degradation (2/6 steps found)
• mixed acid fermentation (9/16 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• pyruvate fermentation to propanoate I (2/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (4/10 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• reductive TCA cycle II (5/12 steps found)
• superpathway of vanillin and vanillate degradation (3/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
• methylaspartate cycle (9/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)
• syringate degradation (3/12 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37, 1.1.1.38

Use Curated BLAST to search for 1.1.1.37 or 1.1.1.38

Protein Sequence (342 amino acids)

>mRNA_2810 K00026 MDH2 malate dehydrogenase (Rhodosporidium toruloides IFO0880)
MFAATRQSSRLARSFSTSARANTRVSVLGAAGGIGQPLSLLLKLNPLVSHLSLYDIRLAA
GVAADVGHCNTPSTCVGYGPENDGLKKALEGAEIIIIPAGMPRKPGMTRDDLFNANASIV
RDLAQAAAEVAPKARIGIIANPVNSTVPIVAEVFKKAGVYDPKRLFGVTTLDIVRASAFL
SGIAGTEPKDTNVPVVGGHSGPTIVPLLSQLPAGKKVVEQGGETLAALVKRIQYGGDEVV
KAKDGAGSATLSMAYAGADFTNSLLRAMKGEKGVTLCTYVESPLYKDQGVEFFSSPVELS
SEGTVAKIHPVGDLHPTEQKLLEACLPDLKKNIAAGVKFMSA