Protein Info for mRNA_2817 in Rhodosporidium toruloides IFO0880

Name: 11185
Annotation: KOG2946 Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 127 to 145 (19 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details PF04893: Yip1" amino acids 98 to 252 (155 residues), 69.7 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: None (inferred from 57% identity to cci:CC1G_14428)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>mRNA_2817 KOG2946 Uncharacterized conserved protein (Rhodosporidium toruloides IFO0880)
MTSAHHAYEIAADDDEDDLVATSGQGLLPTHTAPASSSADKGKGRATSPLLEGKIGSAPG
GGPSVGTRTQRQTTFGGIQTETRYTGTDTLDEPVSETIMRDLRAIGNKIVQVLHPTSENA
VLRDWDLWGPLIFCLLLAILLSTNAPAEQSLPIFTGVFVIVWLGSVVVTLNAKLLGGKVS
FFQSLCVLGYCIFPLDLAALVSVFVRMLWVRLPVCAAAFGWSVWAAVNFLGGTRLEKDRA
VLAVFPLFMLFFLLAWMTMLS