Protein Info for mRNA_2831 in Rhodosporidium toruloides IFO0880

Name: 11199
Annotation: HMMPfam-short chain dehydrogenase-PF00106,PRINTS-Glucose/ribitol dehydrogenase family signature-PR00081,SMART--SM00822,SUPERFAMILY--SSF51735

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 4 to 154 (151 residues), 29.9 bits, E=7.9e-11
• PF00106: adh_short
  • amino acids 5 to 204 (200 residues), 99.2 bits, E=3.3e-32
• PF13561: adh_short_C2
  • amino acids 9 to 209 (201 residues), 84.3 bits, E=1.5e-27

Predicted SEED Role

No annotation

Protein Sequence (243 amino acids)

>mRNA_2831 HMMPfam-short chain dehydrogenase-PF00106,PRINTS-Glucose/ribitol dehydrogenase family signature-PR00081,SMART--SM00822,SUPERFAMILY--SSF51735 (Rhodosporidium toruloides IFO0880)
MPHTYLISGTSRGLGLGLVRYLLSSSKDTKVVAGARNPSSATELHSLANEFGEERLYLLK
LDVENAVEVKNAIAELESSGFSGDSGLDTLIANAGISNALPPPSETTPELVQANLNVNLY
GVMNLVSASLPLLRKGQAKQIFAVSSTVGSLGGVFSENSMYTAYCMSKTILNMYMRKLSV
ELKEDGFTVVMYSPGFVKTNLTGGYGDMDVEQAVKLGVENVIRKVTKADNGKFLDVDGSV
APW