Protein Info for mRNA_2881 in Rhodosporidium toruloides IFO0880

Name: 11249
Annotation: KOG0254 Predicted transporter (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 transmembrane" amino acids 73 to 97 (25 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details amino acids 394 to 415 (22 residues), see Phobius details amino acids 422 to 440 (19 residues), see Phobius details amino acids 485 to 508 (24 residues), see Phobius details PF06609: TRI12" amino acids 195 to 559 (365 residues), 36 bits, see alignment E=3e-13 PF07690: MFS_1" amino acids 371 to 507 (137 residues), 37.7 bits, see alignment E=1.2e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (621 amino acids)

>mRNA_2881 KOG0254 Predicted transporter (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MSTSSHDEAKDAQYAGNVQREHEHAHFAQTASAEVPPVQTTHDASPPSYAVATQAGVLKV
ESVNRVWGRNSRVALFVGIALASYIYSLDGTTTYLYAAGATSSFGQHSLLGAIATAQAIV
LAVTKPLSAKFADVFGRAEAFVLAVFFYCLGYIIIAACSNVHTYACVGYAALQILIQIVI
ADCTNLRWRGLISSLTSIWFFINAFVSGNIAQGVLATSNWHWGCFIILIPVTLSPIIGTL
LWAQIRAKRLGLDATDLVEEHGGTVAKAKDTRPLGTRMLSWALDIDALGLLLFGAGWACI
LLPLTLANKGTLWWTSYKIIVLLVVGGLTLITFVAYERFGAKKPLFPFRFFKSPTVLACA
LIGFFDFVSFYLQYTYQYSFIAVVKDWSVKDQGYFAYTQSLALTLGAILAGFYQLYFRRT
KWLLLFGLLVRLLGVGLMIHSKGAHGSTAELVIVQVLQGLGGGIASASTQLLAQASVPHQ
DVATVTAFVLLFAEIGNAVGTAIATAIWRDWMPRELTSHLSGILSSTEIASVFGSITTAV
TYRGTNDAAYDGIVGAYTETMKVLLIAATAIDVDYRAAVVPPFLALCVSNIKLSNDQNAV
EGEDLAGRPTDARREKEADLA