Protein Info for mRNA_2899 in Rhodosporidium toruloides IFO0880

Name: 11267
Annotation: K15276 SLC35B2, PAPST1 solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 829 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 148 to 165 (18 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details PF08449: UAA" amino acids 13 to 342 (330 residues), 136.2 bits, see alignment E=1.5e-43 PF00685: Sulfotransfer_1" amino acids 635 to 727 (93 residues), 32.5 bits, see alignment E=6.7e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (829 amino acids)

>mRNA_2899 K15276 SLC35B2, PAPST1 solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (Rhodosporidium toruloides IFO0880)
MAERSGTRRVSLMLHAAGLISIYSLYGVLQEKIMKNSTYGSNNEHFTSSSLLIVFNRLFS
IAVGLGILLWKTRQQPEHGGFSQRLRPASPYYAYASVALANFASTTCQYQALRYVSYTTQ
SLAKTSKMIPVLVVGACIYRKSYMTREWVAGGVILAGCATYLFSSPPTPHGHAAPSVTST
DTWDGIIGAAYLLGYLFFDGLVSSTQEAVFGKNPSSSDPFGPESPVLDQMIYTNVFAALI
AIAASVASTATGSFWPNLDLLLTSARLLWDVCVFSAASAVGLIVLLNTIASFGALTSSLI
MTFRQFLSILINAAAFNNFSSVSLVGWVGVFWVASGIWIKINKSYDPPKQPKVVFDVGDD
TEESRGMLEKETASPSMSSDSHVADVRPNRAKQVVMQYIVPLAIPVFVAILLAPFFSSSS
IAVGKPLESSASATIGSSLPVTMDSVAAPVTEGELGDDQPLADDDGMAGSELDALTSPTN
DLSDIVDSAGAGDPAIALSSTDKAEEDALNSAEASEAAELAVAVEGGSWDSQLHDAMSAA
CKTELVTIPYQTTIRTAFASFPRSGNSYLRSLIERATGYQTSSVYCDRGLERTFHGECNH
RLNFFVKTHFPALPPVISPQNTALVNYYKQFDSAVHVVRNPLDAVASWWHLRHASPTAEG
YQNHEAKVDLPGGKFGEAQRGDIIDLAKRWRRHTTYWQQAPLLTHTLRYEDLKAQPIPNM
MSLLSFLLPDDDLPPLGDIACIAEHHENLQAYHSRRSSDFAQWDNYEPSLRQDILNIVRR
PFCAFGYRRILLEAKGDLPDVQEAMDGYCDLGMSDPDYDETRESWGKGD