Protein Info for mRNA_2908 in Rhodosporidium toruloides IFO0880

Name: 11276
Annotation: KOG3098 Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 114 to 139 (26 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 364 (341 residues), 54 bits, see alignment E=1.3e-18 PF05978: UNC-93" amino acids 62 to 172 (111 residues), 31.5 bits, see alignment E=1.4e-11

Best Hits

KEGG orthology group: None (inferred from 56% identity to mgr:MGG_01874)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>mRNA_2908 KOG3098 Uncharacterized conserved protein (Rhodosporidium toruloides IFO0880)
MTTADTNGYPTTTARRTFYRTTLFQMLVVGQISFLAPGLWYVALAQGLGAGGALEPYLVS
LSNSLVFVLMGFGCVFAPIIVNKLGVKNTLIIGTLGWSVYTAALYQNNRYGTEWFVIFGA
VICGLSAGTYWASEGAIVLAYPEPHKRGKYLALWLFFKNSGQIVSGAINLATNAHNSKGG
KVNYKTLISFIALQVVAIPLAFLISNPEKVQRQDRSEIPLSDKTSTKEQIRLLWQTCSSR
KVGVLLPVFFSSWFYWGYASLHLTLYYSVRARALASFLSAICGVIATSLLGTFLDSRRFS
LAFRARAGAALVFTVFSGILVWAIVVQHQFTQHNPGKLDWTDTSGRFSKGFGMLIMLNAS
GNAVQNYLYWLISHLAADLGETTRYAGLLRGVESWGQCCSFGMNSTHFNPTYTVVINIVF
WAVSLPSSFLTITKVGKEEGYGAERAGEVEDVDRERSIDEKTVEGDQASSKEREEEVV