Protein Info for mRNA_2912 in Rhodosporidium toruloides IFO0880

Name: 11280
Annotation: HMMPfam-Bacteriorhodopsin-like protein-PF01036,PRINTS-Bacterial opsin signature-PR00251,SMART-Bacteriorhodopsin-like protein-SM01021,SUPERFAMILY--SSF81321

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 217 to 242 (26 residues), see Phobius details PF01036: Bac_rhodopsin" amino acids 57 to 232 (176 residues), 121 bits, see alignment E=2.9e-39

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>mRNA_2912 HMMPfam-Bacteriorhodopsin-like protein-PF01036,PRINTS-Bacterial opsin signature-PR00251,SMART-Bacteriorhodopsin-like protein-SM01021,SUPERFAMILY--SSF81321 (Rhodosporidium toruloides IFO0880)
MHPEVVKRYTSSISTNPVTSNIGLSRPGSNWCWALFGIFALSMLTLGVVAHSRPKPSNLG
YTSVPVEFVRSGSRGANQLAGGAPFPPTRSIFYARYIGWAITWPLLVLLVLLATGFNLSR
IFIVLFFTLFSIISALIGTLIRTRYRWMYYVFAVSALFYVVWHLFHPAPRSARRLGADRG
RAVRSAATSFGLLFLIYPIVWGLCEYGIVLTVSSEMFWYGVLDFLTRVVWLFAFLFAIEG
LAYERFRFHSGKATDGADDRGNATGTNVVGNQSGPMRSTNGGGGPASTGAGNTSAEAGSG
GGEPAGAGRRQLNGDVGSGGAAPNARGDNFRETV