Protein Info for mRNA_2913 in Rhodosporidium toruloides IFO0880

Name: 11281
Annotation: K13703 ABHD11 abhydrolase domain-containing protein 11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF12146: Hydrolase_4" amino acids 45 to 151 (107 residues), 45.9 bits, see alignment E=1.6e-15 PF00561: Abhydrolase_1" amino acids 46 to 151 (106 residues), 70 bits, see alignment E=9.3e-23 PF00975: Thioesterase" amino acids 47 to 131 (85 residues), 34.5 bits, see alignment E=8.9e-12 PF12697: Abhydrolase_6" amino acids 48 to 315 (268 residues), 64.7 bits, see alignment E=7e-21 PF07859: Abhydrolase_3" amino acids 55 to 201 (147 residues), 23.1 bits, see alignment E=2.1e-08

Best Hits

KEGG orthology group: None (inferred from 44% identity to scm:SCHCODRAFT_104052)

Predicted SEED Role

"Esterase ybfF (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>mRNA_2913 K13703 ABHD11 abhydrolase domain-containing protein 11 (Rhodosporidium toruloides IFO0880)
MLRSALASATGVARYTLARQHRCLATAAHTVRLAFEKQAAPDSSKPPLVVLHGLFGSKQN
WRSLAKGLAQRLGRDIFTLDLRNHGHSPHKRECAYDDLASDVKAFIEQEEKLDDCVVVGH
SMGGKVAMALALGGCDALSRLVVIDIAPAVGKISPEFQAYLDAMKEIDEARVMSRKEADV
ILQKTESDLGVRQFLLTNLDRGSPSDPYRFRLPLHYLANAIGEIGNFPYQPGERVFEQPS
LFLKGESSPPLAAGRLPSACESITNDELACWTGSRSKYINSRNIPLIKQFFPNSQLETLE
TGHWVHAEKPKEFIESLDRFLNQ