Protein Info for mRNA_2920 in Rhodosporidium toruloides IFO0880

Name: 11288
Annotation: KOG2234 Predicted UDP-galactose transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 446 to 463 (18 residues), see Phobius details amino acids 503 to 523 (21 residues), see Phobius details amino acids 530 to 551 (22 residues), see Phobius details amino acids 557 to 574 (18 residues), see Phobius details PF04142: Nuc_sug_transp" amino acids 241 to 388 (148 residues), 123.3 bits, see alignment E=6.2e-40 amino acids 435 to 574 (140 residues), 82 bits, see alignment E=2.4e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>mRNA_2920 KOG2234 Predicted UDP-galactose transporter (Rhodosporidium toruloides IFO0880)
MAPLSRPAILSLTALTIHYSVLSIVLHISRTAPGRRYHASSAIFLTELGKIIVSWGLVLC
TGELRGAVRERKRLRAIWTLRDIEEREREEDEERRRKAEEEQERVWKEVKQAGASEAEKA
ADEGYSDATVVPVTLHRRTSSEVKTSPISPTRTGPGSSLCINVALAQATATSPAKPPAPS
LALIPATPAPYPSPIRTPDESALYPERHLNGRTASPVSPSILDDVFELEWWRTLWASVFG
EGVWKLAVLAALFCFQGNAQYVASGNLSVPLFQLAYQLKIPATAMCSVILLNRALSRQQW
AALFVLTFGVGLVQLFSVTSSSTVQAAAAAASAVDSAKSEAGSSLDALAVHHDGGPNQAL
GLAAVVAACMSSGFASVYFERILKVASTPSTTSSPNPSHDASHALSPTLPSSHQPLLSDH
QELQSPSLPSPDSIVPSGKPSLWIRNIQLSMFGLVVGFPVVLWEMRGCLGALDYEYLDQG
IWSRAEYITRTALGGFFDGFDSALPWVVVFLQLTGGLLSAALVMQHADNLLKCFSTSLSI
LLSVAASVILFSFHVTLGIFVGAVLVLGATFAYTSPARDWRWRPVSGR