Protein Info for mRNA_2924 in Rhodosporidium toruloides IFO0880

Name: 11292
Annotation: K11663 ZNHIT1, VPS71 zinc finger HIT domain-containing protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF04438: zf-HIT" amino acids 130 to 154 (25 residues), 27.6 bits, see alignment 1.1e-10

Best Hits

KEGG orthology group: K11663, zinc finger HIT domain-containing protein 1 (inferred from 44% identity to ppl:POSPLDRAFT_98077)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>mRNA_2924 K11663 ZNHIT1, VPS71 zinc finger HIT domain-containing protein 1 (Rhodosporidium toruloides IFO0880)
MLDLPRRLTAFPTPAAQRAANPSAVIADSEYVARRVKRHLNDLERTNYTEPTTGPSAYGE
ADDESKGPTALGKDDDGKKRKRSMAVRSLLMYRKNLAALLDESNLSEAPPNQPNYLTAAA
PPSRHPPLAICSVCGYTGKYSCLRCGLKYCDIGCRTTHDESRCERR