Protein Info for mRNA_2927 in Rhodosporidium toruloides IFO0880

Name: 11295
Annotation: K07955 ARL8 ADP-ribosylation factor-like protein 8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF00025: Arf" amino acids 10 to 178 (169 residues), 156.7 bits, see alignment E=1.3e-49 TIGR00231: small GTP-binding protein domain" amino acids 18 to 170 (153 residues), 71.4 bits, see alignment E=3.9e-24 PF01926: MMR_HSR1" amino acids 21 to 130 (110 residues), 37.6 bits, see alignment E=6.5e-13 PF09439: SRPRB" amino acids 21 to 133 (113 residues), 36.2 bits, see alignment E=1.3e-12 PF08477: Roc" amino acids 22 to 132 (111 residues), 65 bits, see alignment E=2.4e-21 PF00071: Ras" amino acids 23 to 178 (156 residues), 83.1 bits, see alignment E=5.4e-27 PF04670: Gtr1_RagA" amino acids 25 to 144 (120 residues), 34.8 bits, see alignment E=3.6e-12

Best Hits

Swiss-Prot: 57% identical to ARL8B_RAT: ADP-ribosylation factor-like protein 8B (Arl8b) from Rattus norvegicus

KEGG orthology group: None (inferred from 59% identity to smo:SELMODRAFT_185994)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>mRNA_2927 K07955 ARL8 ADP-ribosylation factor-like protein 8 (Rhodosporidium toruloides IFO0880)
MGLFSGLLNWLRSLFWSKSMDIACIGLQNAGKTSLVNILTNNQFSESMIPTVGFNLRKIQ
KGNVTLKVWDLAGQPRFRSIWERYCRGVNAIVWVLDSADRETFSTSRAELHALLEKAELK
GIPLLVLANKNDLPDHATVDEVISALGLATIRNREVSCYAISAKSSRNIDITLAWLMKRA