Protein Info for mRNA_2949 in Rhodosporidium toruloides IFO0880

Name: 11317
Annotation: K02267 COX6B cytochrome c oxidase subunit 6b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 83 PF02297: COX6B" amino acids 18 to 74 (57 residues), 66 bits, see alignment E=1.5e-22

Best Hits

Swiss-Prot: 60% identical to COX12_SCHPO: Cytochrome c oxidase subunit 6B (cox12) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02267, cytochrome c oxidase subunit VIb [EC: 1.9.3.1] (inferred from 66% identity to cci:CC1G_13336)

MetaCyc: 57% identical to cytochrome c oxidase subunit VIb (Saccharomyces cerevisiae)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (83 amino acids)

>mRNA_2949 K02267 COX6B cytochrome c oxidase subunit 6b (Rhodosporidium toruloides IFO0880)
MSDSETQTYVLQTAGFDARFPNTNQSRHCFQAYVDYFRCVNAKGEDFPACKTFWRTYHSL
CPNEWIAKWDEQREENKFPAKLD