Protein Info for mRNA_2972 in Rhodosporidium toruloides IFO0880

Name: 11340
Annotation: K03850 ALG10 alpha-1,2-glucosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 68 to 81 (14 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 181 to 206 (26 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 375 to 393 (19 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 427 to 443 (17 residues), see Phobius details amino acids 455 to 474 (20 residues), see Phobius details PF04922: DIE2_ALG10" amino acids 29 to 438 (410 residues), 390.2 bits, see alignment E=7.2e-121

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>mRNA_2972 K03850 ALG10 alpha-1,2-glucosyltransferase (Rhodosporidium toruloides IFO0880)
MPTASWWACYAAWAAASVGVAMRINRTVGEPYMDEIFHVPQAQAYCRGDWKYWDPALTTP
PGLYILPAVLAHAKGLLEPIVAHLPANFAAFDPCALPSLRAINLLLSLFLPFLYSSLLHL
LHGLSDDTRPGRRSYDWQGLVIAMFPLVQWWSWLFYTDMASVVCILLCWRTALQQRHVQS
ALLGAISLLFRQTNIVWIAFIAAQAAIRELELPKKEVKLAGGKAVDPQLWDARPGHLAQT
PFAVARVALAQLPTLAPVIAAYLPVFLAFLAFIRWNGGIVLGDKQNHVATVHVAQLYYLV
AFAGVLFWPVIVTPRRVRVACYELIGSPRRAMLSLLALAVICYTIKHYTIAHPFLLADNR
HFCFYLWRRVINLRWWTRYALSPGYLLAGRLIYDQLANARLMTLSTLLLLTGATSAVLIP
SPLLEPRYFLLPLLILRLYFSPSSTTSTPTKRRHLVFEAAFYLAIQAACVWLFLEKPFVW
DIQVGEDGKGLEGRDEREVGRLQRFMW