Protein Info for mRNA_3085 in Rhodosporidium toruloides IFO0880

Name: 11453
Annotation: K06269 PPP1C serine/threonine-protein phosphatase PP1 catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF16891: STPPase_N" amino acids 10 to 57 (48 residues), 76.7 bits, see alignment 1.5e-25 PF00149: Metallophos" amino acids 59 to 250 (192 residues), 138.4 bits, see alignment E=4.6e-44

Best Hits

Swiss-Prot: 92% identical to PP1_EMENI: Serine/threonine-protein phosphatase PP1 (bimG) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K06269, protein phosphatase 1, catalytic subunit [EC: 3.1.3.16] (inferred from 94% identity to cci:CC1G_07643)

MetaCyc: 49% identical to serine/threonine-protein phosphatase 2A catalytic subunit (Homo sapiens)
Phosphoprotein phosphatase. [EC: 3.1.3.16]

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.16, 3.4.24.-

Use Curated BLAST to search for 3.1.3.16 or 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>mRNA_3085 K06269 PPP1C serine/threonine-protein phosphatase PP1 catalytic subunit (Rhodosporidium toruloides IFO0880)
MAAEGQDIDLDSVIDRLLEVRGNRPGKQVQLQEYEIKFLCTKAREIFINQPILLELEAPI
KICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF
ILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPD
LQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKH
DMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNSGAMMSVDETLLCSFQILKPA
EKKKTFAYGGAGQGRPVTPPRKAKGGKK