Protein Info for mRNA_3091 in Rhodosporidium toruloides IFO0880

Name: 11459
Annotation: K13303 SGK2 serum/glucocorticoid-regulated kinase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 PF00069: Pkinase" amino acids 219 to 472 (254 residues), 245.4 bits, see alignment E=1.4e-76 PF07714: Pkinase_Tyr" amino acids 219 to 457 (239 residues), 111.3 bits, see alignment E=1.1e-35 PF12330: Haspin_kinase" amino acids 268 to 371 (104 residues), 29.1 bits, see alignment E=1e-10 PF00433: Pkinase_C" amino acids 494 to 535 (42 residues), 48.1 bits, see alignment 3.1e-16

Best Hits

KEGG orthology group: K08282, non-specific serine/threonine protein kinase [EC: 2.7.11.1] (inferred from 67% identity to uma:UM00484.1)

Predicted SEED Role

"Serine/threonine protein kinase PrkC, regulator of stationary phase" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>mRNA_3091 K13303 SGK2 serum/glucocorticoid-regulated kinase 2 (Rhodosporidium toruloides IFO0880)
MSSWKLGKKLKEATTGRSASSTVTPTSANTPQPPASPNPSTSDSSGPPVPRSGLLTIRVV
EARKLTLPQGVNLPAGIRDAVEQAQGAYARGGRESLQRKQMWWLPYVVLEFDKNEVLIDA
LGGELSSPTWMFRAHFDVSRVSDVSISAYLRTSPIVPGQNRNDMGNDLFLGGVKFLPAFD
ANKPTDQWFRATSGTGEFHIQVTFKPATTQHLTINDFDLLKVIGKGSFGKVMQVRKKDTG
RIYALKTIRKAHIVSRSEVTHTLAERTVLAQVNNPFIVPLKFSFQNAEKLYLVLAFVNGG
ELFHHLQREGRFSEERSRFYAAELLCALEHLHQFNVIYRDLKPENILIDYVGHIALCDFG
LCKLNMSESETTNTFCGTPEYLAPELLLGHGYQKTVDWWTLGVLLYEMLSGLPPFYSENT
NEMYQKILTDPLRFGDEISPDARSLLTGLLTRDPQQRLGVAGAETIKTHPFFAKHIDFKK
LMKKQIQPPFKPSVESAADTSNFDTEFTQELPVDSVVEDSHLSSTVQQQFAGFSYVQPSG
AFGESVR