Protein Info for mRNA_3133 in Rhodosporidium toruloides IFO0880

Name: 11501
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 69 to 91 (23 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 135 to 152 (18 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 194 to 219 (26 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 323 to 349 (27 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details amino acids 504 to 524 (21 residues), see Phobius details PF07690: MFS_1" amino acids 75 to 481 (407 residues), 131.8 bits, see alignment E=3.1e-42 PF00083: Sugar_tr" amino acids 115 to 248 (134 residues), 48.2 bits, see alignment E=8.1e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>mRNA_3133 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MGCWIAESTHTRETHVPGTSLLDDLKASPATQEQSTHLKRDKNGIVLVPQPSDDPRDPLN
WPTWKRELAYWNIVFATSLVGAIGPLIAPGFVQIAKEFQVSVNKVAGTNAALVLAIGAAM
IPVSTVAIKWGRRPVYIWGAAFLLAGSIWSAAKPDLDNLLASRVIQGLGMAPVESTATAT
IGDLFPVHQRGMRVAVWGLSLLGGINLAPIVAGTIISTIGWQYCFWTIVPFFALSLIFMI
LFLPETAYDRAPIANSLSTSTGDIAASEDEKDEKGFSEQVEDVNAIEKQDGYLPAKTVWQ
EMLPWSGYVNKDPIWKIFLRPFLMLFSPATFWCFLTYGIATLLLVLVSATNSLIFSKSYG
FTSRQTGLVSISPLVASILMSLVAGYIADFLATFMARRNKGVFEPEMRLLLMIPYAVLVI
AGYVGWAVSYRNHDHWMVPVIMYGFVNAGQKFLSTASVTYIIDVHREQTSEVQACVNFLK
NVISYRIGTEINGWVVGLGIEQTFYVLAGISTGIALTTIPMYHYGKRCRAWVSRNQKLFA
L