Protein Info for mRNA_3145 in Rhodosporidium toruloides IFO0880

Name: 11513
Annotation: HMMPfam-haloacid dehalogenase-like hydrolase-PF08282,SUPERFAMILY--SSF56784,TIGRFAM-Cof-subfamily Cof-like hydrolase-TIGR00099,TIGRFAM-HAD-SF-IIB HAD hydrolase, family IIB-TIGR01484

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR00099: Cof-like hydrolase" amino acids 61 to 327 (267 residues), 165.9 bits, see alignment E=1.3e-52 TIGR01484: HAD hydrolase, family IIB" amino acids 61 to 300 (240 residues), 88.8 bits, see alignment E=5.4e-29 PF08282: Hydrolase_3" amino acids 62 to 327 (266 residues), 172.2 bits, see alignment E=1.8e-54 PF05116: S6PP" amino acids 220 to 306 (87 residues), 33.5 bits, see alignment E=3.3e-12

Best Hits

Predicted SEED Role

"HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>mRNA_3145 HMMPfam-haloacid dehalogenase-like hydrolase-PF08282,SUPERFAMILY--SSF56784,TIGRFAM-Cof-subfamily Cof-like hydrolase-TIGR00099,TIGRFAM-HAD-SF-IIB HAD hydrolase, family IIB-TIGR01484 (Rhodosporidium toruloides IFO0880)
MSGFRSAASSFSSIHRPQGISSPWDTPVATPHESPATTPGGSPILRDSDGKRLPKADDIK
MILSDVDGTLFTDAHELHPTTRDAIRYIRQTRPNVPFIPVTGKQLTSCGDLVKELGIEDM
PAACMHGAIIYDKDRKIEQSMSLDPHFVRDVARLMRKHNKSTFLYVEEWNAMVTKEENGS
KDWEQVARGFDPAVRDERETDFMQRVLKGKEKISKIFLPMDESVVPDMIDLIEKTFHKVP
FKITRALPYIIEIVAEGVDKSAALAFFCAKFNIDPKNVISFGDGENDVGMFGASGYSVAM
ANGMPKPKAVATYQTGSNNDGGVGQFLNAIFRPDHTEGPDARLNPDHLSMLDERLGAVES
PLAAGAYP