Protein Info for mRNA_3156 in Rhodosporidium toruloides IFO0880

Name: 11524
Annotation: K12662 PRPF4, PRP4 U4/U6 small nuclear ribonucleoprotein PRP4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 PF08799: PRP4" amino acids 52 to 80 (29 residues), 56.6 bits, see alignment (E = 2.3e-19) PF00400: WD40" amino acids 178 to 207 (30 residues), 16 bits, see alignment (E = 2.7e-06) amino acids 212 to 257 (46 residues), 23.5 bits, see alignment 1.2e-08 amino acids 263 to 299 (37 residues), 28.7 bits, see alignment 2.8e-10 amino acids 310 to 341 (32 residues), 23.6 bits, see alignment (E = 1.1e-08) amino acids 346 to 383 (38 residues), 35.8 bits, see alignment 1.5e-12

Best Hits

KEGG orthology group: K12662, U4/U6 small nuclear ribonucleoprotein PRP4 (inferred from 53% identity to cne:CND05530)

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (532 amino acids)

>mRNA_3156 K12662 PRPF4, PRP4 U4/U6 small nuclear ribonucleoprotein PRP4 (Rhodosporidium toruloides IFO0880)
MASMDIDFDDIESREVDLATSASHPETARLLSELDRKKLARKIALPTNDGEVRARLRELG
EPITLFGEGPADRRDRLRDLIAKARLERGEAMDVEEQEESESEGEEEDEKDEEFYTEGTA
ALKKARRDIAEYSLPRARRRLVRQRLDATIPLARLMDVRKAIFDNLSSFTNLGSQIGDTR
AISALRFSPDSSMLLTGSWTGQAKLWSVPACKEIRVLKGHKERIGGVAWHPEATLSQSAT
AVNFATSGADNVIKLWDLENDNSLRTLTGHDNRVCRIAFHPSGRYLGSASYDETWRLWDV
ETGGELLLQEGHSKEVYAIAFQQDGALVASGGLDAIARVWDLRSGRTVSVLSGHSRDILS
VDFSPNGYQVATGSNDDTIRIWDLRMHQAICTIPGHKSAISDLKFFQAPPKAGAYPLTDL
PRAFKDLPIFSDGWSSDPDASGDVEAKPNGTNEGEHGEKPDFPVAGSFLVSCGFDGYIKV
WSADDWQLVRSMSNDQAGKVMSVDVSSDARFIAGGQYDKSFRLYARSDVDLS