Protein Info for mRNA_3177 in Rhodosporidium toruloides IFO0880

Name: 11545
Annotation: KOG2164 Predicted E3 ubiquitin ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 757 PF13920: zf-C3HC4_3" amino acids 135 to 184 (50 residues), 34.5 bits, see alignment 4.5e-12 PF13639: zf-RING_2" amino acids 135 to 179 (45 residues), 29.2 bits, see alignment 2.8e-10 PF00097: zf-C3HC4" amino acids 136 to 179 (44 residues), 36.5 bits, see alignment 1.1e-12 PF13445: zf-RING_UBOX" amino acids 136 to 177 (42 residues), 30.3 bits, see alignment 1.1e-10 PF13923: zf-C3HC4_2" amino acids 136 to 179 (44 residues), 28.5 bits, see alignment 3.3e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (757 amino acids)

>mRNA_3177 KOG2164 Predicted E3 ubiquitin ligase (Rhodosporidium toruloides IFO0880)
MPLDATSPIKPVAAAPTPSRRNGGRQRDQQDLNHLLGFTLPPRAPPPPTHLPRRSNRRNP
NYVAFDRSRFVHQFRFIVRPDRDYTAHFADPDIHLDWSDILQVILPTSASALSSVTTAKL
DQGTDGASAGGGIPACPICLSEPTAARMTKCGHVFCYPCVLHYLALADNGAKSRNCPVCH
DSIHAKDLKSVKWFDPTSSSGLPPPLPSVPQLPNDMDDDLARALELSKLDAHPHASTSDP
HSSISSRGEKLKMRLIRRPQMTTLALPRSATWPSDAVPPLRAPWQFTPDAFTYAKFMLGA
PDYMRDELLAQKAELEREILTLRRFGRRGGTDEELGIVFVDAALRKVDEQLAKAEALKTT
SVMTARKRSLREIQQVQEVKGKADEASKLPPVTDTSSSEVEHEGEARPAPALPAPVPVCD
PVPLDFLQSRGTTPLSTAAPVFVPSSPPSSRSSVPPPVPLSPPRNRPHQRRNVLAPPPPE
EDPAYYFYQAATGQPIFLQPLDIRILKSHFGTYQSMPNEIEVVVEGADEGSMNDELRRRC
KWLSHLPIASDVVFVEADLGALVPRKALEPYATALKQRRNKRRNKARKEDRAKAESELKA
AEQMPVFESTYAFGAPAFGPPHASSWDDVSAFPAPPLASSPPQPTSQPARPPPATSSWSR
PSFASALHASSRSSPSWASQGAHDDDFDDRWDEFEERLGRQRASTPRTPSSGNFNVSEGG
GQAKNAGGGADGGGGGRGKKGKKVTLHLSGAALRGTG