Protein Info for mRNA_3236 in Rhodosporidium toruloides IFO0880

Name: 11604
Annotation: K01755 argH, ASL argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 9 to 463 (455 residues), 565.9 bits, E=3.8e-174
• PF00206: Lyase_1
  • amino acids 12 to 309 (298 residues), 286.5 bits, E=3e-89
• PF14698: ASL_C2
  • amino acids 372 to 439 (68 residues), 82.7 bits, E=2.5e-27

Best Hits

Swiss-Prot: 58% identical to ARLZ_SCHPO: Probable argininosuccinate lyase (argx) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 63% identity to uma:UM04497.1)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• urea cycle (5/5 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• L-arginine biosynthesis IV (archaea) (6/9 steps found)
• canavanine biosynthesis (2/4 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Protein Sequence (468 amino acids)

>mRNA_3236 K01755 argH, ASL argininosuccinate lyase (Rhodosporidium toruloides IFO0880)
MAEQMAQKLWGGRFTTGTDPLMWEFNQCLSYDKALYAVDVAGSKAYALALSRTTPPILTT
HELSEIHRGLDQVQSEWESGTFEIKQDDEDIHTANERRLSEIIGKDVGGKLHTGRSRNDQ
VATDMRLWLAQEVQRDIEWIQGVVGILAVKAEEWIDHLAAGFTHLQRAQPIRFSHFLLAH
AHSFASDLDRFRDLLPRISVLPLGSGALAGNPFCVDRELLRNELGFQTIGGNSMQSVADR
DFVAEYLFVCSLLMVHISRFAEDIIIYSSSEFNWLVCGDAYSTGSSIMPQKKNPDACELL
RGKSGRTVGQLAGFLTTLKGLPATYNKDLQESQEPMFDAAVTVGKSLRILQGVVSTLKIF
PENMKKSLTPDMLATDLAEYLVRRGIPFRETHHISGSCIRLSEQRGVPLSALSLEDFKSV
SPHFGDDVHEVFNFETSVERRDAKGGTSRRAVLEQVEALKSKLVQSAK