Protein Info for mRNA_3253 in Rhodosporidium toruloides IFO0880

Name: 11621
Annotation: KOG1201 Hydroxysteroid 17-beta dehydrogenase 11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 19 to 35 (17 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details PF00106: adh_short" amino acids 98 to 282 (185 residues), 123 bits, see alignment E=2.2e-39 PF08659: KR" amino acids 99 to 246 (148 residues), 38.5 bits, see alignment E=2.3e-13 PF01370: Epimerase" amino acids 99 to 251 (153 residues), 28 bits, see alignment E=3e-10 PF13561: adh_short_C2" amino acids 106 to 285 (180 residues), 94.6 bits, see alignment E=1.5e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>mRNA_3253 KOG1201 Hydroxysteroid 17-beta dehydrogenase 11 (Rhodosporidium toruloides IFO0880)
MASPPKFSVDDVNRFLDRVPFSVPGAAAIAAYSFFKARSILGPSLHFLDHVRANRWLSLL
LAFVALKTLHRTLNRLTRNHGWKADPPVWSFDKGKGDVVLITGGSTGIGKEMVEILSRKT
NKIAVIDLAPPTYDAHGVHYYKCDITDPAAIAEVAKKIRADVGNPTIVVNNAGIARGKTI
LDTKPEEFMLTYKVNVLGAHNILREFLPYIVKRNHGHIMTTASSASYASIPQLSEYACSK
AAVLALHEALTGELRYRYNAPKVRTSVICPTKVSTQMGDAMKDTDVQFLTPTLSAPWLAK
QMVKIIESGLSDHLVTPHFAHLLLPSLRSGPDYYRWFVAKVGKTHETITDARNEVQMQKY
KFVGELDKLHNMVTGK