Protein Info for mRNA_3257 in Rhodosporidium toruloides IFO0880

Name: 11625
Annotation: K13869 SLC7A11 solute carrier family 7 (L-type amino acid transporter), member 11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 112 to 132 (21 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 343 to 366 (24 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 442 to 461 (20 residues), see Phobius details amino acids 467 to 486 (20 residues), see Phobius details amino acids 498 to 518 (21 residues), see Phobius details amino acids 524 to 542 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 113 to 521 (409 residues), 188 bits, see alignment E=2.9e-59 PF00324: AA_permease" amino acids 121 to 486 (366 residues), 92.6 bits, see alignment E=2.3e-30

Best Hits

KEGG orthology group: None (inferred from 47% identity to scm:SCHCODRAFT_66164)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>mRNA_3257 K13869 SLC7A11 solute carrier family 7 (L-type amino acid transporter), member 11 (Rhodosporidium toruloides IFO0880)
MSSDAVPLEDRSGAPGRPSSSSESTEPSHTPLRTADYDEHPSDEEDAAEGLLARADGAEG
MEEKHAGFPRRARARTASFSFDFSSRLLQLEASDELSSAERGVNGGKVKEHVSFVGGVAL
IVGIVIGSGIFSSPGVVAAETGSVGTALLVWAIAGVLSWAGGSSFAELGTALPGNGGHQV
YLNAAFGPLAAYCYSFSAVTALKPGSQAIISLISAEYLCRIFWHTAFEPDPRAAVRTIPT
VAIKLVAIAGLFLISAVHAWSTKAGTRTQLVVTVFKVLALLLVFIGGIVYLITSKPASDF
SFHGSSHKPAGYALALFSALWTFDGWDAANYVAKDVAPGVLPLMINSSMAVIVVLFLAAN
VSYFLVLPFDIATATTTIGLDFGRALAGPVGGLLFAIVISISALGALNGTLYTSSRLIVA
ASEQGFLPRAFSNFHKSRKTPINGILLSSTLSTIFICLGDFSSLTLFYGVAAWTWNFSAV
IGLLVLRRTEPTLKRPYRTFLVTPILFASTALFLIVLSCFSRPIQSFAAFAFCVAGVVPY
YLHVRRSGAFQDDFERGAMIDDAFVAEPRASDGLEMT