Protein Info for mRNA_3273 in Rhodosporidium toruloides IFO0880

Name: 11641
Annotation: K13754 SLC24A6, NCKX6 solute carrier family 24 (sodium/potassium/calcium exchanger), member 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 1000 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 785 to 803 (19 residues), see Phobius details amino acids 809 to 830 (22 residues), see Phobius details amino acids 839 to 857 (19 residues), see Phobius details amino acids 863 to 886 (24 residues), see Phobius details amino acids 906 to 932 (27 residues), see Phobius details amino acids 949 to 969 (21 residues), see Phobius details amino acids 978 to 999 (22 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 98 to 236 (139 residues), 108.3 bits, see alignment E=1.8e-35 amino acids 843 to 993 (151 residues), 70.7 bits, see alignment E=7.2e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1000 amino acids)

>mRNA_3273 K13754 SLC24A6, NCKX6 solute carrier family 24 (sodium/potassium/calcium exchanger), member 6 (Rhodosporidium toruloides IFO0880)
MAPSSGSGVRQRHRLYLVLALAAIFNVVCWRAIAPLSSLASSPRSRSTAAHLAKRSLERL
VEDGGGSDESEALIDWLAWYTSAAPGAPRVAIFALMVLWLIFLFAFVGICASEFFCPNLS
HIASRLGLSESVAGVTFLAFSNGSPDVFSTFAALRNDSGSLAIGELIGAASFIVSVVAGT
MALIKPFRVARRTFLRDIGFFSIAVLLTLGILYDSHIHLWEAFLMVGLYAVYVLYVAVGT
WWEGRVEAKRKRLREARGEYEHDEAEGDIVNGDVEWEDEEGAITLPPSGTSTPSLNRSRS
YRDASPAYSSSSIIYHPPGSPFASPPMTPTFSPSHSRSRATSLSGPAGFNTRPPPTPLMG
GGRRRSRSVRPSLLGAIEFRDVVNSLSSDRSSAANILSVFGGAHQHHPHSHEVLDEVAEE
HEHALEEGLGLGFGGASDARGRRRALSQPEHPGALQLGGADDVLAERVMADAERRRQRMS
LGERRGTWTGRSATVDDEEDERGLVDLSKGVDNPWKDAQSPLIHDDSRSSTIRRVPSILL
TTDSGSDTILADHPSAPPSTAAAGEKPKHRSNRRRLLHAWRCALFPSLQSFRSKSIVGKC
TALLCVPALLVLNLTLPVVEEPSDEGDASWNGEKADREGGIDAEAAIEAIGRQLHSPAIA
HTHADSHPHPHAHSHSHAAHDNSPSHRLQHIRAEAAEAEAPSPSHAWEEVSTTPLDSPTP
ARALATGPLDYFRITSPNRTTGSATATPVPVDEDDGVRRMDEGKGARQLSEEELEDLAQE
HVTRVLTALQCFLGPLFVVSALFVEELRWWYLVAAGLVGLLAASVAYRFFHNSRHPGRVS
LCFLGFAIAMVWILMIVNEVVGVLLTLGHIFGISDAILGLTIFAMGNSLGDLVANATVAR
MGYPTMAIAACFGGPMLNILLGVGLSGTYLILFGPARGQPIHVPMSKTLLVSGVGLFAIL
VGTLVVVPLNGYRMSKRVGAALIAAWMCVMAINVGVEIWA