Protein Info for mRNA_3293 in Rhodosporidium toruloides IFO0880

Name: 11661
Annotation: K01440 PNC1 nicotinamidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 45 to 259 (215 residues), 52.8 bits, E=2.9e-18

Predicted SEED Role

"Nicotinamidase (EC 3.5.1.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 3.5.1.19)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
• aldoxime degradation (1/3 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.19

Protein Sequence (323 amino acids)

>mRNA_3293 K01440 PNC1 nicotinamidase (Rhodosporidium toruloides IFO0880)
MRATAAPTLAPLLRRLNPSTLNASTQLLRPRFARYTPPTMPSHPALLLVDIQHDFLPPSG
ALAVPHGDAILEDAVYPLLDRGKWDLDFHPPGHVSFASRHQSPTFSKTTVSRPLTHEPIE
QELWPDHCVQGTRGCEFDEGVQRRLERLRSERGEQAVRIIQKERNSPTKPEDLSGASSTA
AELTQALLDSRITHLVIVGLALDFCVLASALAAKRASVAHGDQWEVWVVREGTRAVYADK
EDEVLKRMRSEGIKVREWAAAEDSNSSRSHMKDANHIRAQTSPRSRYSLWLTAHAATTSP
GELRISMTAPRPSALLGPSCASP