Protein Info for mRNA_3301 in Rhodosporidium toruloides IFO0880

Name: 11669
Annotation: K08197 ARN MFS transporter, SIT family, siderophore-iron-H+ symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 378 to 396 (19 residues), see Phobius details amino acids 402 to 422 (21 residues), see Phobius details amino acids 441 to 463 (23 residues), see Phobius details amino acids 515 to 537 (23 residues), see Phobius details

Best Hits

KEGG orthology group: K08197, MFS transporter, SIT family, siderophore-iron:H+ symporter (inferred from 58% identity to cpw:CPC735_041550)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>mRNA_3301 K08197 ARN MFS transporter, SIT family, siderophore-iron-H+ symporter (Rhodosporidium toruloides IFO0880)
MGEIDVSMGVARIEAINSCLTTPLRAWLMFSAFLVAYAYGLDATVRGTLQSYATSSFQNH
SLLATVNVLKSIVAAASYPAYSKIADTFGRPEVVLFSVVMYVIGTIVEATSTNIQSFCAG
AVLYQFGYSAAILIVEVIISDLTSLRSRLFFSYIPALPFIINCWAGANVVAQIQATTTWQ
VGIGLWAAVYPFCCLCLLAPLYIAQRRARRAGKLDGYLTPFQQLGFKRLMVTIFWELDLV
GSILIIAVLALILLPFTLAGGVDKQWAAAHNIAMLVIGVVVCIPLLIVWETKYAKVPALP
FHLLKTRTVLGCLGIATFLDVCWYMQAGDYLYTVLVVAFHESVLSATRITSMYSFASVIT
GTLAGLFVRFCLPRLKPIILVGVSLWFVAFGLLIHYRGGASAHSGIVGAQVLLGISGGLF
PYPAQTLIQTAGNHQHTAILLSIYLAIYNVGSAIGATISGAIWTQILPGKLEIALGGNTT
AVQEWYGSPFTAITTAAGQWGQPDRMAVVDAYRHVQRLLCITGIAFAVPLLLCALVVRDP
ILGKEQSLPDAEKDIRARRVNKI