Protein Info for mRNA_3311 in Rhodosporidium toruloides IFO0880

Name: 11679
Annotation: K00134 GAPDH, gapA glyceraldehyde 3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF00044: Gp_dh_N" amino acids 11 to 113 (103 residues), 96.9 bits, see alignment E=8e-32 PF02800: Gp_dh_C" amino acids 187 to 352 (166 residues), 175.3 bits, see alignment E=7.5e-56

Best Hits

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>mRNA_3311 K00134 GAPDH, gapA glyceraldehyde 3-phosphate dehydrogenase (Rhodosporidium toruloides IFO0880)
MPHSTLPDVPRIGISGFGRIGRAVFRASLERDDLQVVAINHTAPNLRTFIYSIKYDSTHG
HLKQADELSVDEAKNCLYFRGRKIQLFSERDPLKLDWKSAGAEYIVEATGKHCTTATAGL
HLQSGGKKVVISAPAKDSETKTIVVGVNRKEYKPDMDVVSNASCTVRFPASRPRRSANLA
FLQTNCLAPLAKILHDTFGIEAGMMTTVHASTSSQPILDGYSKKSVRLGRGVGSNIIPTT
TGASKAVALVLPELAGKFTGLSVRVPVNNVSMVDLTVRLQRPAATKEDLLFPLREAAAGR
LKYSTGPISNVIAVNDEELVSHDFVGWQQSCIVDSAATIMLNPTLAKVVAWYDNEVAFSI
RMLDLIRYMYNVDNNLLASAAGTPASLASSA