Protein Info for mRNA_3348 in Rhodosporidium toruloides IFO0880

Name: 11716
Annotation: K09831 ERG5, CYP61A sterol 22-desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details PF00067: p450" amino acids 95 to 491 (397 residues), 177.7 bits, see alignment E=2e-56

Best Hits

KEGG orthology group: K09831, C-22 sterol desaturase [EC: 1.14.14.-] (inferred from 57% identity to cnb:CNBF1100)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>mRNA_3348 K09831 ERG5, CYP61A sterol 22-desaturase (Rhodosporidium toruloides IFO0880)
MPSQYVSAPASTPSALGDAIERLTGGKLELPQFTPTTVATSLVAVVVTLLIAEQALWRSR
KRHLPGKNFQIPVIGQFAESLNPTMEAYKRSWATPLASVSVFNIFIVIASTTDYARKILN
SSSATEPCLVRSAKQILLPENWVFLNGKVHNEYRKGLNVLFTPKALEIYLRVQDQIYRKF
FNSWLADPTPGFQPYQMKFRDLNMMTSLRVFCGSYISETGAQEISDKYWLITQALELVNF
PFAFPGTKVWNACKAREVAVKHLSKAAADSKAAMKAGKEADCLLDAWVEQIIAGKVREYS
DKEMALVLLSFIFASQDAMSSSITFAFQLLADHPAVLAKIREEQSRVRAGDLDSPMSLSW
LEQMPYTNAVTKEVLRYRPPVIMVPYLAKKDFPINDEYTVPKGTMIIPSFWNSLHDPEVY
PDPEDFIPERWMPGGANADGGDSKNWLVFGAGAHKCIGQNYVYMHMSAVIGSAAMLMDWE
HERTPESDEIQIIATLFPKDGCRLKFSRREQQDL