Protein Info for mRNA_3388 in Rhodosporidium toruloides IFO0880

Name: 11756
Annotation: KOG1577 Aldo/keto reductase family proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF00248: Aldo_ket_red" amino acids 19 to 280 (262 residues), 156.9 bits, see alignment E=3.5e-50

Best Hits

Swiss-Prot: 41% identical to Y2161_MYCVP: Uncharacterized oxidoreductase Mvan_2161 (Mvan_2161) from Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)

KEGG orthology group: None (inferred from 41% identity to ani:AN5986.2)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>mRNA_3388 KOG1577 Aldo/keto reductase family proteins (Rhodosporidium toruloides IFO0880)
MTASVPSFVLNSGARIPSVGLGCWMGAPVTAGSAVDEETYTMVRNALDAGYTHFDTASGY
RSEEAVGKAIRDSGIAREKLFVTTKLALARKSVVDAFEQSLKKLDVGYIDLYLMHWPLTI
DASTGKTIPFPQSPTFSEVWIEMEKLLETHKGKVRSIGVSNFSIKNLEILLKTAKVVPAV
NQVEGHPYLPSLELDGYCKSKGIHMTAYSPLGAGATSPLLTDDLVLSLAAKYDSTPAAVV
LAWNVARGWSVVPKSSNPTRLKQNITLPPLSTSDLSLLSSLHKSSPSKHRSLFVYPGSGE
KGDLFGWRVKEDLGWEYEVRSEVPEWMK