Protein Info for mRNA_3477 in Rhodosporidium toruloides IFO0880

Name: 11845
Annotation: K07088 K07088 uncharacterized protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 71 (24 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 425 to 448 (24 residues), see Phobius details amino acids 461 to 482 (22 residues), see Phobius details amino acids 542 to 564 (23 residues), see Phobius details amino acids 576 to 596 (21 residues), see Phobius details amino acids 614 to 635 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 53 to 483 (431 residues), 113.3 bits, see alignment E=4.5e-37

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (643 amino acids)

>mRNA_3477 K07088 K07088 uncharacterized protein (Rhodosporidium toruloides IFO0880)
MGILLPGSPVLLSLLAPTTDPANSTASTALDALAYVPKQPSQANPLPALISVVVESILEV
AILCAVGWFLAKKGIVDAKAKKTLNKINTSLFTPCLLFNKVAFSLTPDKLAELYIIPIGF
CLVSAFSAGVAYLLGRVAGLKKGQRDFAIACATFQNSNSLPIALLQSLIGEKLPLAWGPH
DTRDGMLGRGLTYLVLYSSLGIIVRWSIGVRLLSSAETQSPTGDTSIERDPERGEAEGPG
VREDETDDRENDGLLASSEGDGNGENVRRSILKNGGGARRTRESTASSSTLTPEPSSSTS
SNGNGKLVPLPPDADDQGAFSTPQKRRKRTRIFQSFPNTPIPSVYSASSLRSSADSASFD
QDEDADGEGDDSLASGWDDEDAEWGARRGFGRRWLSTGSSSPFFTRVKKGTSRAWRKTKR
VWAKVADFMTVPLWAAVLSLVVACIPPLQSVLNKAEPVKSAIRSAGSCSVPITLVTLGAY
FYRPSAASAADTSPLRREEQELPRSFRSKLLHLVKKPFKPRKNGDGDGEGDGDKAKGETS
TVVVAVVSRMVVVPLVLIPLFAWYAKVTVNVADDPVFVVVACLLIGSPTAITLAQITSSA
AGPTFEKLISRTLLVSYALLTAPSTIILVLAALWIDGLQHPHT