Protein Info for mRNA_3493 in Rhodosporidium toruloides IFO0880

Name: 11861
Annotation: K06944 K06944 uncharacterized protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 TIGR00231: small GTP-binding protein domain" amino acids 68 to 217 (150 residues), 84.7 bits, see alignment E=3.2e-28 PF02421: FeoB_N" amino acids 69 to 123 (55 residues), 29.8 bits, see alignment 8.1e-11 PF01926: MMR_HSR1" amino acids 69 to 159 (91 residues), 65.3 bits, see alignment E=1.1e-21 PF16897: MMR_HSR1_Xtn" amino acids 188 to 293 (106 residues), 135.6 bits, see alignment E=1.3e-43 PF02824: TGS" amino acids 294 to 370 (77 residues), 71.3 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 72% identical to YFY7_SCHPO: Uncharacterized GTP-binding protein C9.07c (SPAC9.07c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 78% identity to uma:UM03007.1)

Predicted SEED Role

"GTP-binding protein RBG1" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>mRNA_3493 K06944 K06944 uncharacterized protein (Rhodosporidium toruloides IFO0880)
MGAGPIVEQIKKIEDEQAHTQKNKATSYHLGQLKAKLAKLKRELLTPTSGGGGGPGIGFD
VARSGVASVGFIGFPSVGKSSLMSGLTGTESVAAAYEFTTLTTVPGTLTVHGAPIQILDL
PGIIEGAKDGKGRGRQVIAVARTCNLIFIVLDVLKPLADKAVIEAELEGFGIRLNKTPPN
ISIKKKEKGGIAITNTVPLTKITADEIKAVLSEYRMANADVHIRCDPTVDEFVDVVEGNR
VYIPAIMVLNKIDAISIEELDLLYRIPNSVPISVKEWLNIDELLETMWEKLSLVRVYTKP
RGAKAPDYTAPVVLKKDKCTVEDFCNAIHKDISKQLKHAMVWGTSVKHSRGQKVGLSHVL
ADEDVVTLVKN