Protein Info for mRNA_3503 in Rhodosporidium toruloides IFO0880

Name: 11871
Annotation: K03457 TC.NCS1 nucleobase-cation symporter-1, NCS1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 95 to 119 (25 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details amino acids 292 to 321 (30 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 382 to 399 (18 residues), see Phobius details amino acids 405 to 429 (25 residues), see Phobius details amino acids 454 to 474 (21 residues), see Phobius details amino acids 488 to 509 (22 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 57 to 498 (442 residues), 331.9 bits, see alignment E=3.2e-103

Best Hits

KEGG orthology group: None (inferred from 51% identity to ang:ANI_1_870114)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>mRNA_3503 K03457 TC.NCS1 nucleobase-cation symporter-1, NCS1 family (Rhodosporidium toruloides IFO0880)
MSSVKTLIDRAKIPRQTHLIAVGEDGSVREAKEGDTDVVEVTAEKDMLPVAIDSPLRTWG
AFSLGGYWVAEAFGISQYQVASSAVSAGLSPGATIGAVLLGHFIVSCACAVTGYVGCAYG
INFPSWARTAFGIRGTYLAVICRAIAAIVWFGTQSYQGGQCVQVMLQAIWPSFKHFPNHL
PESAHVTSSMLLCFFIFYLIQLPLLWIHISKLKYLFAVKIVIMPFFGFALFGWAVGRAHG
FGPVFSKPTHILDGRPAAVVFLSAFTSAIAPKATLALNICDFTRYAKNRKVVVWTNILSL
TVLVTLCAILGVVVTSATQVIYGVSTWSPLQVSSLMGSRAAQFFSALPWAISVLATNISA
NSTAVGNDLMVLFPRWINIRRGQYITAVLGLVTCPWIIQSTAKTFTAFLGGYSVFLAPLG
GVLMSEFLLVRKRRISLPDLFTTKSSVYWYSHGWNFRGVVAFVLGIVPCLPGFIRNVNSK
LDIPIQATYVYVCVYPIGVFVGGGIYYLLSTIFPPAPLPTSYSAKQYAGSYDSEEDKEKE
AGVAMQSSIVAV