Protein Info for mRNA_3516 in Rhodosporidium toruloides IFO0880

Name: 11884
Annotation: K01466 allB allantoinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03178: allantoinase
  • amino acids 52 to 449 (398 residues), 500.4 bits, E=2.3e-154
• PF01979: Amidohydro_1
  • amino acids 65 to 444 (380 residues), 124.3 bits, E=7.4e-40
• PF07969: Amidohydro_3
  • amino acids 366 to 445 (80 residues), 38.1 bits, E=1.5e-13

Best Hits

Swiss-Prot: 53% identical to ALN_YEAST: Allantoinase (DAL1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K01466, allantoinase [EC: 3.5.2.5] (inferred from 60% identity to cci:CC1G_06842)

MetaCyc: 53% identical to allantoinase (Saccharomyces cerevisiae)
Allantoinase. [EC: 3.5.2.5]

Predicted SEED Role

"Allantoinase (EC 3.5.2.5)" in subsystem Allantoin Utilization (EC 3.5.2.5)

MetaCyc Pathways

• superpathway of purines degradation in plants (14/18 steps found)
• allantoin degradation to ureidoglycolate I (urea producing) (2/2 steps found)
• allantoin degradation to glyoxylate I (2/3 steps found)
• allantoin degradation to ureidoglycolate II (ammonia producing) (1/3 steps found)
• superpathway of allantoin degradation in yeast (3/6 steps found)
• allantoin degradation to glyoxylate II (1/4 steps found)
• allantoin degradation to glyoxylate III (1/4 steps found)
• superpathway of allantoin degradation in plants (3/7 steps found)
• allantoin degradation IV (anaerobic) (2/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.5

Protein Sequence (464 amino acids)

>mRNA_3516 K01466 allB allantoinase (Rhodosporidium toruloides IFO0880)
MTGSTRYFSSSRVFSAAAPSGAPATVEVDKASGRVKRVHERVIKRDELAGAVDEVDWVDA
GEQWILPGLVDAHVHLNEPGRTEWEGFETGTAAAASGGVTTVIDMPLNAIPPTTTVENLH
IKLNASEGKRHIDVGFWGGVVPDNADDLQPLAKEGVKGFKGFLCESGVDEFPGINEEQVM
RAMKELDAAKSLFLFHAELDNTSHSHNDHEDPSAYSTFLACRPPALEESAIDLIIRCARQ
FPSLRTHIVHLSASSALPALRHARRDLNLPLSVETCFHYLCLSAEQIAKGETLYKCCPPI
RDDANREKLWQALLDGDIDFVVSDHSPCTTELKKLEGGDFLGAWGGIGGLGLGLSLLWTE
ASKRGIATEKVLEWVASRPAKQVGLEGRKGEIKEGADADFVIFDPKESFTINKSELHFKN
RASPYEGLTLAGAVKSTYLRGEKVYDRKTGFKGVEADFPGQLLL