Protein Info for mRNA_3516 in Rhodosporidium toruloides IFO0880

Name: 11884
Annotation: K01466 allB allantoinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 341 to 358 (18 residues), see Phobius details TIGR03178: allantoinase" amino acids 52 to 449 (398 residues), 500.4 bits, see alignment E=2.3e-154 PF01979: Amidohydro_1" amino acids 65 to 444 (380 residues), 124.3 bits, see alignment E=7.4e-40 PF07969: Amidohydro_3" amino acids 366 to 445 (80 residues), 38.1 bits, see alignment E=1.5e-13

Best Hits

Swiss-Prot: 53% identical to ALN_YEAST: Allantoinase (DAL1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K01466, allantoinase [EC: 3.5.2.5] (inferred from 60% identity to cci:CC1G_06842)

MetaCyc: 53% identical to allantoinase (Saccharomyces cerevisiae)
Allantoinase. [EC: 3.5.2.5]

Predicted SEED Role

"Allantoinase (EC 3.5.2.5)" in subsystem Allantoin Utilization (EC 3.5.2.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>mRNA_3516 K01466 allB allantoinase (Rhodosporidium toruloides IFO0880)
MTGSTRYFSSSRVFSAAAPSGAPATVEVDKASGRVKRVHERVIKRDELAGAVDEVDWVDA
GEQWILPGLVDAHVHLNEPGRTEWEGFETGTAAAASGGVTTVIDMPLNAIPPTTTVENLH
IKLNASEGKRHIDVGFWGGVVPDNADDLQPLAKEGVKGFKGFLCESGVDEFPGINEEQVM
RAMKELDAAKSLFLFHAELDNTSHSHNDHEDPSAYSTFLACRPPALEESAIDLIIRCARQ
FPSLRTHIVHLSASSALPALRHARRDLNLPLSVETCFHYLCLSAEQIAKGETLYKCCPPI
RDDANREKLWQALLDGDIDFVVSDHSPCTTELKKLEGGDFLGAWGGIGGLGLGLSLLWTE
ASKRGIATEKVLEWVASRPAKQVGLEGRKGEIKEGADADFVIFDPKESFTINKSELHFKN
RASPYEGLTLAGAVKSTYLRGEKVYDRKTGFKGVEADFPGQLLL