Protein Info for mRNA_3519 in Rhodosporidium toruloides IFO0880

Name: 11887
Annotation: KOG4686 Predicted sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 71 to 91 (21 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 434 to 453 (20 residues), see Phobius details amino acids 466 to 488 (23 residues), see Phobius details amino acids 526 to 549 (24 residues), see Phobius details PF07690: MFS_1" amino acids 314 to 513 (200 residues), 46.6 bits, see alignment E=1.2e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (551 amino acids)

>mRNA_3519 KOG4686 Predicted sugar transporter (Rhodosporidium toruloides IFO0880)
MSSSPAQPAKELISTLPSSLPPTIPFPSPSSSDLSKEVDEKKLDASPEASLAPGEYNAAV
TGHPWRIKGPTLLLVLFLTLGSNFASSSISPLKSTLKKELGIDNAQYANLDTADSLINTV
LPILSGIAIDYFGPIAGALYSSTVILLGTILAGVATTTRSYPLLLVANIITGFGSSTIET
SQSKLYSFYCLGGGIMGFVYGLDTGIGRVYNLAGKLSAVPIMEGTGSYAWTFWVSAILCA
FTFLLTVLLALYERTFPLCARVPTGRQAAVLAAAKLAPGRAPASFGRRWKEERKYFVGSL
VALPACFWIMDVSQLLQSGAVNAYTSNLADAISTTRNKSKAAAGYTSAIGQIIPIVLTPC
LGMVFDRFGRRMHWVTWTASLYVLVFALLAYTTVHPLVPSILGSLALATNVLPWIASIPL
LVPDQARLGTAFGVYKSLNSCGSVIVTVAAGAIQDHAAPGRSDYNAVFAFLIAIKAFDIL
LGLSYNLFDKRYLHGVLRSNDKRLRRMEEEMSEEERSSGLRRPIKVVTVAALGVVGGMIV
TAWVLYLVYAV