Protein Info for mRNA_3539 in Rhodosporidium toruloides IFO0880

Name: 11907
Annotation: K12663 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 16 to 271 (256 residues), 155.8 bits, E=1.3e-49
• PF16113: ECH_2
  • amino acids 21 to 264 (244 residues), 91.6 bits, E=7.3e-30

Best Hits

Swiss-Prot: 49% identical to ECH1_HUMAN: Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial (ECH1) from Homo sapiens

KEGG orthology group: K01828, [EC: 5.3.3.-] (inferred from 48% identity to tad:TRIADDRAFT_19479)

MetaCyc: 40% identical to delta3,5-delta2,4-dienoyl-CoA isomerase (Arabidopsis thaliana col)
RXN-12520 [EC: 5.3.3.21]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

• superpathway of glyoxylate cycle and fatty acid degradation (13/14 steps found)
• oleate β-oxidation (26/35 steps found)
• fatty acid salvage (5/6 steps found)
• valproate β-oxidation (7/9 steps found)
• fatty acid β-oxidation II (plant peroxisome) (4/5 steps found)
• L-valine degradation I (6/8 steps found)
• L-isoleucine degradation I (4/6 steps found)
• methyl ketone biosynthesis (engineered) (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• glycerol degradation to butanol (11/16 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• fatty acid β-oxidation V (unsaturated, odd number, di-isomerase-dependent) (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• fatty acid β-oxidation I (generic) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (4/9 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (1/5 steps found)
• superpathway of phenylethylamine degradation (5/11 steps found)
• benzoyl-CoA degradation I (aerobic) (2/7 steps found)
• phenylacetate degradation I (aerobic) (3/9 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (4/11 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (4/13 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• gallate degradation III (anaerobic) (2/11 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (4/14 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (5/18 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• platensimycin biosynthesis (6/26 steps found)
• Spodoptera littoralis pheromone biosynthesis (3/22 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17 or 5.3.3.- or 5.3.3.21

Protein Sequence (280 amino acids)

>mRNA_3539 K12663 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase (Rhodosporidium toruloides IFO0880)
MSNYESKLIKCTLPSEGVLQVTLARPPVNAYNSELSAELQRHFEQASSDPDVRCVVLTSD
LDKGFTAGLDLFATNLLPEADDPARAALALRQHIIFLQQAVSSIQNCDKPVVAAVHGICF
GAGVDLFSACDVRLCAEGTVFSIKEVDIGLAADIGSLQRLPRVIGNASLLYELALTARNF
GPPEAEKLGLVSRVVSGGKKGVQEAAMELAKVIASKSPIATLSTKHLLNYSREHTVEEGL
RYTQAWNMAMVQASDVPASFQAFTQKKPATYAPLPGPAKL