Protein Info for mRNA_3547 in Rhodosporidium toruloides IFO0880

Name: 11915
Annotation: K02973 RP-S23e, RPS23 small subunit ribosomal protein S23e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00982: ribosomal protein uS12
  • amino acids 8 to 144 (137 residues), 191.6 bits, E=2.5e-61
• PF00164: Ribosom_S12_S23
  • amino acids 31 to 144 (114 residues), 168.9 bits, E=1.4e-54

Best Hits

Swiss-Prot: 88% identical to RS23_NEUCR: 40S ribosomal protein S23 (crp-28) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K02973, small subunit ribosomal protein S23e (inferred from 90% identity to cne:CNG04360)

Predicted SEED Role

"SSU ribosomal protein S23e (S12p)" in subsystem Ribosome SSU eukaryotic and archaeal

Protein Sequence (145 amino acids)

>mRNA_3547 K02973 RP-S23e, RPS23 small subunit ribosomal protein S23e (Rhodosporidium toruloides IFO0880)
MGSCKPRGLLAGRKLRDDRRDNRWADKNYKKRALGTAYRSSPTGGASHAKGIVLEKVGVE
AKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLISGFGRKGKAKGDIPGV
RFKVVKVSGVGLLALWKEKKEKPRS