Protein Info for mRNA_3565 in Rhodosporidium toruloides IFO0880

Name: 11933
Annotation: KOG0254 Predicted transporter (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 861 transmembrane" amino acids 217 to 235 (19 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 349 to 359 (11 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 523 to 543 (21 residues), see Phobius details amino acids 555 to 573 (19 residues), see Phobius details amino acids 593 to 615 (23 residues), see Phobius details amino acids 631 to 651 (21 residues), see Phobius details amino acids 658 to 676 (19 residues), see Phobius details amino acids 688 to 707 (20 residues), see Phobius details amino acids 719 to 745 (27 residues), see Phobius details amino acids 798 to 817 (20 residues), see Phobius details PF07690: MFS_1" amino acids 237 to 570 (334 residues), 72.7 bits, see alignment E=4.3e-24 amino acids 599 to 745 (147 residues), 38.7 bits, see alignment E=9.4e-14 PF00083: Sugar_tr" amino acids 256 to 396 (141 residues), 29 bits, see alignment E=7.8e-11 PF06609: TRI12" amino acids 520 to 762 (243 residues), 32.7 bits, see alignment E=4.5e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (861 amino acids)

>mRNA_3565 KOG0254 Predicted transporter (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MPSPSRPSHPSASSHTSPSSSSATKPHSVPRPLVSALTGTTSGSATPSTSYGSFPPADDP
TAAHGQGAKNQVERLLRAKLGASIGGKGERGQRRWTRSRERLVKSGSEDVYDSDASLEGG
RKDGERIEQDARGFRLDTDEETDEEEREAVHWDEGAPLRRRKSASGEDDGWRDAPSAQPR
NEGERRSGANGSTRQPEEDKQWGVVKMEIMARTWGRKGLFTIYAGLYLISALMSLEGNTT
PTIEPYFLSLLGEHSMLSSVVIVMSIAYAVGKPPMTKILDVFGRAEGICFAAALYSVGYL
ITAAATDVKVYIVARALSALGGQGVQLAQQIIVADTTTLSNRGLITSTVSLPWLLTTWIG
PPLGAFFQRGGPVGYRAAYAVFGILLPLVACLLFCTLYLEWRKIKRKALAEGRKPSTKDL
GFGVTTRRHRTMSSSAYSTTGSPARPKPPHPPAAFSHLAPPPHDFADHLDLESSSAPGSS
RPITAREHREACAATDAANELTKRKRWNMTPWSKAVELWHDLDVLGLVALTVGCVLFLLP
FTLATKRPESWGDGLIWLLIFSGALILVFFGYYELHHASIPLLPPRLLKNRTIVGGSAMG
FFHFASQFCYESFFTSFLQVARGHSPQDASYISQSYIFAACVAALLAGYLAKITNRYKWI
GIAGVLIHAVGVWLMMRSRNLDGSTFELVLSQLIGGVGGGFTTIAVQTGCQSVVGHQDVA
IATAIFLTITQVGGAVGGSIAGAVWSTSLPRRLAYHLPSSEQSHIPSIIASLPYALSFPS
GSATRIAINKAYVDVQKILNGLAMAMLVPGLLSMCAMKDVNLGKDDQGGEGVVVLGRASF
LACEDELTSSETSSLLGGSPE