Protein Info for mRNA_3609 in Rhodosporidium toruloides IFO0880

Name: 11977
Annotation: K00235 SDHB, SDH2 succinate dehydrogenase (ubiquinone) iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13085: Fer2_3
  • amino acids 21 to 125 (105 residues), 119.4 bits, E=1.5e-38
• TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein
  • amino acids 23 to 243 (221 residues), 284.2 bits, E=3.2e-89
• PF13183: Fer4_8
  • amino acids 159 to 232 (74 residues), 27.6 bits, E=6.4e-10
• PF13534: Fer4_17
  • amino acids 161 to 234 (74 residues), 36.7 bits, E=1e-12
• PF13237: Fer4_10
  • amino acids 161 to 230 (70 residues), 28.7 bits, E=2.3e-10

Best Hits

Swiss-Prot: 76% identical to SDHB_ASHGO: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (SDH2) from Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)

KEGG orthology group: K00235, succinate dehydrogenase (ubiquinone) iron-sulfur protein [EC: 1.3.5.1] (inferred from 77% identity to cci:CC1G_09250)

MetaCyc: 70% identical to succinate dehydrogenase iron-sulfur protein subunit (Saccharomyces cerevisiae)

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (13/14 steps found)
• TCA cycle III (animals) (10/10 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• succinate to cytochrome bd oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
• succinate to plastoquinol oxidase (1/2 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• succinate to chytochrome c oxidase via cytochrome c₆ (1/3 steps found)
• succinate to cytochrome c oxidase via plastocyanin (1/3 steps found)
• methylaspartate cycle (9/19 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.3.5.1, 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Protein Sequence (249 amino acids)

>mRNA_3609 K00235 SDHB, SDH2 succinate dehydrogenase (ubiquinone) iron-sulfur subunit (Rhodosporidium toruloides IFO0880)
MQHARTLATAVESKPEHLKSFKVYRWNPDKPTEKPYLQEYKIDLNKCGPMVLDAILKIKN
ELDPTLTFRRSCREGICGSCAMNIDGVNTLACLKRIDKDSKDVKIYPLPHMYVIKDLVPD
MTQFYKQYKAIQPYLQAEKPADGREHLQSKEDRKKLDGMYECILCACCSTSCPSYWWNQD
QYLGPAVLMQAYRWVADSRDTQKAARLEKLANPFSLYRCHTIFNCSKTCPKGLNPAKAIA
ALKQEMASA