Protein Info for mRNA_3641 in Rhodosporidium toruloides IFO0880

Name: 12009
Annotation: K17615 PPG1 serine/threonine-protein phosphatase PPG1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF00149: Metallophos" amino acids 45 to 237 (193 residues), 124.2 bits, see alignment E=5.4e-40

Best Hits

Swiss-Prot: 68% identical to YD44_SCHPO: Putative serine/threonine-protein phosphatase C22H10.04 (SPAC22H10.04) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01090, protein phosphatase [EC: 3.1.3.16] (inferred from 85% identity to lbc:LACBIDRAFT_232344)

MetaCyc: 57% identical to serine/threonine-protein phosphatase 2A catalytic subunit (Homo sapiens)
Phosphoprotein phosphatase. [EC: 3.1.3.16]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.16

Use Curated BLAST to search for 3.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>mRNA_3641 K17615 PPG1 serine/threonine-protein phosphatase PPG1 (Rhodosporidium toruloides IFO0880)
MLDLDGAISILLRKKLLGEALLKEICEKTKELLMRESNVVHIQAPVTVVGDIHGQFYDLI
EIFRIGGYSPHTNYLFLGDYVDRGLFSVETISLLTCLKLRYPDRVQLIRGNHESRAVTQT
YGFYSECVRKYGSPAVWQYFTDMFDFLTLSVVIDDRIFCVHGGLSPSVHTLDQIKIIDRF
REIPHEGPMADLVWSDPDPDKEEFSISPRGAGYTFGSQVVKKFLDSNNMVHILRAHQLCM
EGFSVLYDDKLSTVWSAPNYCYRCGNMASILEVGPNGEKHFNVFDAAPENERDGPQQQQP
QQGQGPSSVRADTH