Protein Info for mRNA_3683 in Rhodosporidium toruloides IFO0880

Name: 12051
Annotation: KOG0069 Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00389: 2-Hacid_dh" amino acids 111 to 373 (263 residues), 48.8 bits, see alignment E=8.7e-17 PF02826: 2-Hacid_dh_C" amino acids 166 to 344 (179 residues), 185.3 bits, see alignment E=1.1e-58 PF03446: NAD_binding_2" amino acids 201 to 326 (126 residues), 30.2 bits, see alignment E=7.5e-11

Best Hits

Swiss-Prot: 42% identical to GOR1_YEAST: Glyoxylate reductase 1 (GOR1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 52% identity to uma:UM01396.1)

MetaCyc: 49% identical to D-2-hydroxyacid dehydrogenase (NADP+) (Aspergillus oryzae)
(R)-2-hydroxyacid dehydrogenase. [EC: 1.1.1.272]

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.272 or 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>mRNA_3683 KOG0069 Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) (Rhodosporidium toruloides IFO0880)
MQRLFTRSLTPAVPLARTAPSIACPPARRPFSMTPSLSSPTANGTAKPAVLMLDKITLAT
ELYDELAKGWTVIPLTSTTREEFIADCKTKYTEAQGIYRHFKGDSNKVTGLFDPELVAAL
PPKLHFLTHNGAGYDQINIPACTERRLQVSNVPVAVDGATADTALFLLLGAIRQFGRAQH
SLREGKFNAGLPLSNDPAGKKLGIVGMGGIGRAFARRARALGMSIVYHNRNRLSPDLEDG
AEYISSLDELLSTSDVVSLNLPLNPKTKHLMGTEQFKRMKKSAILINTARGGVVDEKALV
KALEDGDIASCGLDVYENEPKIDDGLLRLAREGDPRVFLLPHVGTVTVETQQEMEAVCLR
QLDHGFKTGKLAFWVPEQKGHF