Protein Info for mRNA_3719 in Rhodosporidium toruloides IFO0880

Name: 12087
Annotation: K04043 dnaK molecular chaperone DnaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 PF00012: HSP70" amino acids 35 to 636 (602 residues), 875.3 bits, see alignment E=1.9e-267 TIGR02350: chaperone protein DnaK" amino acids 35 to 636 (602 residues), 905.7 bits, see alignment E=5.9e-277 PF06723: MreB_Mbl" amino acids 167 to 402 (236 residues), 45.6 bits, see alignment E=4.5e-16

Best Hits

Swiss-Prot: 70% identical to HSP77_YEASX: Heat shock protein SSC1, mitochondrial (SSC1) from Saccharomyces cerevisiae

KEGG orthology group: K04043, molecular chaperone DnaK (inferred from 77% identity to mgl:MGL_3087)

MetaCyc: 63% identical to chaperone protein DnaK (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Chaperone protein DnaK" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (660 amino acids)

>mRNA_3719 K04043 dnaK molecular chaperone DnaK (Rhodosporidium toruloides IFO0880)
MLSAARYSGLRAARTPRSASLVQQRFNSGKVSGPVIGMDLGTTNSCVALMEGKVPRVLEN
SEGGRTTPSVVAFTKDGERLVGLPAKRQAVVNFENTFFATKRLIGRKFSDAEVQKDLNNV
PFKIVKHSNGDAWLEARGQKYSPSQIGAFVVGKMKETAEGFLGKPVKHAVITVPAYFNDS
QRQATKDAGTIAGLDVLRVINEPTAAALAYGLDRNDSRQVAVYDLGGGTFDVSILEMQKG
VFEVKSTNGNTHLGGEDFDIALVNHIVEAFKKESGLDLSKDRMAIQRIREAAEKAKIELS
STAQTDINLPYITADASGPKHINLKFTRSQLEQLVGPLIQKTIEPCKKALSDAGMKASEV
EEVILVGGMSRMPKVVETVKSVFGRDPSKGVNPDEAVAVGAAIQGGVLAGSVTDVLLLDV
TPLSLGIETLGGVFTRLINRNTTIPTKKSQTFSTAADGQTAVEIKVFQGERELVRDNKML
GNFQLVGIPPAPKGIPQIEVTFDIDADGIVNVSAKDKATNKDQSITIAASSGLSDKEIES
MIAQAEAHAEADKARRELIEAANSADSVAAETEKALNEFKEQVDADEAKKVQGLITELRE
LNVKAQVEGSDVKPEDIKTKVSETQQASLNLFKKVYESRQSQGNSNSESSSSEPSSEEKK