Protein Info for mRNA_3729 in Rhodosporidium toruloides IFO0880

Name: 12097
Annotation: K15280 SLC35C2 solute carrier family 35, member C2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 62 to 81 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 329 to 345 (17 residues), see Phobius details PF03151: TPT" amino acids 64 to 344 (281 residues), 149.3 bits, see alignment E=2.4e-47 PF08449: UAA" amino acids 81 to 346 (266 residues), 40.2 bits, see alignment E=3.7e-14 PF00892: EamA" amino acids 202 to 340 (139 residues), 28.2 bits, see alignment E=2.9e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>mRNA_3729 K15280 SLC35C2 solute carrier family 35, member C2 (Rhodosporidium toruloides IFO0880)
MSFSTSTPRSLARTPSPNFGSKSRGGSAQHGHNFSVGTHSLLSSRQLSGTSRLAQSLDTP
SCWLALYFAFNLGLTLFNKLVLQGFPFPWTLTAIQMLSGTIGTQVLLQRGVFTQARLTTK
ENGIMVMFSGLYTINIAVSNLSLHLVSVPFHQVVRAMTPLFTILITMVFFRKRHSRQTYL
SLLPVVAGVAFATYGDYSFTAWGFILTLLGTLLAALKTIITNRVQVGRLKLHPLDLLVRM
SPLAFMQCVFFGWWSGELDRVRVYGATEMTRHKAIALAVNGAIAFGLNIVSFTANKKTSA
LTMTVAANVKQVLVIVLAVLIFNVSLNPTNLFGISLTLIGGAWYAKVELNEKNARAAAAA
AQNNLSPMPASNEKLG