Protein Info for mRNA_3736 in Rhodosporidium toruloides IFO0880

Name: 12104
Annotation: K00573 E2.1.1.77, pcm protein-L-isoaspartate(D-aspartate) O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 7 to 242 (236 residues), 171 bits, see alignment E=1.6e-54 PF01135: PCMT" amino acids 10 to 240 (231 residues), 194.4 bits, see alignment E=2.2e-61

Best Hits

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>mRNA_3736 K00573 E2.1.1.77, pcm protein-L-isoaspartate(D-aspartate) O-methyltransferase (Rhodosporidium toruloides IFO0880)
MMAWRCSGSTNAELVDNLVRGSLLQTPRVIEAFKRVDRRFYVQDKYEAYQDSPSYIGYGA
TISAPHMHAHAVENLEPFLKPGANVLDVGSGSGYLCGIFHSLVQPGGTVLGIDHLDGLVT
MARRNLANDPSTAPALCDDQDSPVDPKVPNSKTMQVIKADGRMGAPKEFLPHGGWQAIHV
GAAAPHLPQPLIDQLASPGRMFIPVGSALQAIWQIDKDAEGNVTKKKLFGVSYVPLTDAQ
EQYPENGSP