Protein Info for mRNA_3754 in Rhodosporidium toruloides IFO0880

Name: 12122
Annotation: K01641 E2.3.3.10 hydroxymethylglutaryl-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01154: HMG_CoA_synt_N
  • amino acids 19 to 190 (172 residues), 283.7 bits, E=5.8e-89
• TIGR01833: hydroxymethylglutaryl-CoA synthase
  • amino acids 20 to 463 (444 residues), 611.8 bits, E=4.6e-188
• PF08540: HMG_CoA_synt_C
  • amino acids 193 to 464 (272 residues), 295 bits, E=7e-92

Best Hits

KEGG orthology group: K01641, hydroxymethylglutaryl-CoA synthase [EC: 2.3.3.10] (inferred from 63% identity to cci:CC1G_00827)

Predicted SEED Role

"Hydroxymethylglutaryl-CoA synthase (EC 2.3.3.10)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis or Ketoisovalerate oxidoreductase or Leucine Degradation and HMG-CoA Metabolism (EC 2.3.3.10)

MetaCyc Pathways

• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (10/10 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (7/7 steps found)
• isoprene biosynthesis II (engineered) (7/8 steps found)
• mevalonate pathway II (haloarchaea) (5/7 steps found)
• ketogenesis (3/5 steps found)
• mevalonate pathway IV (archaea) (5/8 steps found)
• ferrichrome A biosynthesis (2/5 steps found)
• mevalonate pathway III (Thermoplasma) (4/8 steps found)
• superpathway of ergosterol biosynthesis I (16/26 steps found)
• superpathway of cholesterol biosynthesis (14/38 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Terpenoid biosynthesis
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.10

Protein Sequence (484 amino acids)

>mRNA_3754 K01641 E2.3.3.10 hydroxymethylglutaryl-CoA synthase (Rhodosporidium toruloides IFO0880)
MSPAPSTRFQPHTPNPATRPQNVGIHAIEVYSPLRCIDEADLERFDGVPAGKYTIGLGQE
RMAFCDDREDINSFLLTVTKTLLEKYEIPPASIGRIDVGTETLIDKSKSVKTLLMDLFPG
NSDIEGIDSKNACYGGTAALFNAVNWVESSSWDGRYAIVVAGDIAIYAEGGARPVGGAGA
CAMLIGPDAPLVLEPVHGTHMANVYDFYKPHLSSEYPEVDGPLTQTCYPNALEKSYDAFR
TKESRRLGNSKGDKKEVSLDDFDYVCFHSPYGKLVQKGFARLMYKDFLSNPDAERFSSVS
KAFLEPERAANVLDKEIEKAFTTLSSADFKAKVGPSTLTSKRLGNMYAGSLYGAFASLLD
TVDSQTLQGKRIALYSYGSGLAASFFTVRVKGDTSEIHEKLKLKERLEKNQVRSCEEFIE
ALKLREEKHNISGYTPSGRIEDIPAGAYYLHHCDSKHRRVYKIRGHEGEQDVVESANGDK
PHVA