Protein Info for mRNA_3769 in Rhodosporidium toruloides IFO0880

Name: 12137
Annotation: K10669 TRPT1, TPT1 2'-phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 47% identical to TRPT1_DANRE: tRNA 2'-phosphotransferase 1 (trpt1) from Danio rerio

KEGG orthology group: K10669, 2'-phosphotransferase [EC: 2.7.1.160] (inferred from 43% identity to aml:100474877)

Predicted SEED Role

No annotation

MetaCyc Pathways

tRNA splicing I (1/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.160

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>mRNA_3769 K10669 TRPT1, TPT1 2'-phosphotransferase (Rhodosporidium toruloides IFO0880)
MSLTPPAASLTATHSPAVPPSSSSSKPPKTARGRPTDDPDTRWSKTLSYILRHGAAKEGL
KLRDDGFVRVEELMKRPKLKGCDMATLERIVKDNAKQRFSMRPEPTGENGTEELWIRANQ
GHSIKVEQLELKKVEKAEDVPLMVHGTYYRLWPAIEKEGLKVMTRNHIHCAVGLTGETGV
ISGMRANCDLFIYLDVPKLLADGIPIYTSTNNVVLTAGVDGVVAPQYFAKVVRKNGDVLV
PAPKSA