Protein Info for mRNA_3777 in Rhodosporidium toruloides IFO0880

Name: 12145
Annotation: K20346 TMED4_9_11 p24 family protein alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 182 to 201 (20 residues), see Phobius details PF01105: EMP24_GP25L" amino acids 19 to 209 (191 residues), 161.6 bits, see alignment E=1e-51

Best Hits

KEGG orthology group: None (inferred from 60% identity to scm:SCHCODRAFT_75828)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>mRNA_3777 K20346 TMED4_9_11 p24 family protein alpha (Rhodosporidium toruloides IFO0880)
MRLPLLLASLLALAQSCTALYFYLGAGENRCFIEELPKDTIVVGHYKGEEWQESSKSWIT
NDQLGIQIVVAEVESGEKVVNTRGLPEGKFTFTSHEAGDHTICLKSNYTGGWFSTTQVRM
HLDIAVGEAKVDEEGERAHVKDLAEKVRDLNHRLADIRREQQFQREREAEFRVLSERTNS
RAVWWSVFQLAVLAGTCFWQLRHLRLFFESKKLCVRVSLTLTKPG