Protein Info for mRNA_3787 in Rhodosporidium toruloides IFO0880

Name: 12155
Annotation: K01626 E2.5.1.54, aroF, aroG, aroH 3-deoxy-7-phosphoheptulonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 TIGR00034: 3-deoxy-7-phosphoheptulonate synthase" amino acids 19 to 367 (349 residues), 518 bits, see alignment E=4.3e-160 PF00793: DAHP_synth_1" amino acids 57 to 356 (300 residues), 331.1 bits, see alignment E=2e-103

Best Hits

Swiss-Prot: 61% identical to AROG_ECO57: Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive (aroG) from Escherichia coli O157:H7

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 71% identity to cci:CC1G_07125)

MetaCyc: 61% identical to 3-deoxy-7-phosphoheptulonate synthase, Phe-sensitive (Escherichia coli K-12 substr. MG1655)
3-deoxy-7-phosphoheptulonate synthase. [EC: 2.5.1.54]

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I alpha (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.54

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>mRNA_3787 K01626 E2.5.1.54, aroF, aroG, aroH 3-deoxy-7-phosphoheptulonate synthase (Rhodosporidium toruloides IFO0880)
MSSTPRGTTPATTALNALDDRRIKNIRPLIPPQILMEDYPLGLRAAATVLEGRKSGEEIV
RGEDDRLIVVVGPCSIHDVRAALEYAKLLKAYADEASDDLLIVMRVYFEKPRTTVGWKGL
INDPQLNNTYQINKGLRLARGLLLEIANMGIPTAVELLDTISPQYVADLVSWGAIGARTT
ESQVHRELASGMSMPIGFKNGTDGSLQIAIDAIGAAAASHSFLSVTKQGISAIVETEGNP
ACHVILRGSNQGPNYEKEYVKKAAEGLRKAGLVDKVMIDCSHGNSSKKFERQVIVAEDVA
KQLGEKETAEHIMGVMIESHLVEGKQSIPANGPQNLVYGQSVTDACISWTTTVQVLDTLR
QGVRARRALLGAESGRKGIDNTALATASERASSVQGVRDFNDPAQFPAA