Protein Info for mRNA_3825 in Rhodosporidium toruloides IFO0880

Name: 12193
Annotation: K02941 RP-LP0, RPLP0 large subunit ribosomal protein LP0

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 216 to 229 (14 residues), see Phobius details PF00466: Ribosomal_L10" amino acids 4 to 103 (100 residues), 81.3 bits, see alignment E=7.4e-27 PF17777: RL10P_insert" amino acids 109 to 178 (70 residues), 76.1 bits, see alignment E=2.6e-25 PF00428: Ribosomal_60s" amino acids 229 to 310 (82 residues), 76.3 bits, see alignment E=3.4e-25

Best Hits

Swiss-Prot: 66% identical to RLA0_PODAS: 60S acidic ribosomal protein P0 from Podospora anserina

KEGG orthology group: K02941, large subunit ribosomal protein LP0 (inferred from 66% identity to scm:SCHCODRAFT_85263)

Predicted SEED Role

"LSU ribosomal protein P0 (L10p)" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>mRNA_3825 K02941 RP-LP0, RPLP0 large subunit ribosomal protein LP0 (Rhodosporidium toruloides IFO0880)
MVRSRDEKQAYFAKLKDYIETYPSIFVVNVDNVGSNQMHQIRQAVRGKGTILMGKNTMVR
RAIRLILADHPDFERFLPLVKGNVGFVFTSADLKEIRDVIVSNKVAAPAKAGAFAPNDIY
VPAGNTGMEPGKTSFFQALNIPTKIARGTIEIVSDVHLVVAGARVDASQATLLNMLGISP
FTYGMKIIQIFSDGQLFPESVLDVSDDELLKRFMSGVTAVAAISLALNYPTLASVTHSLV
NSYKNLLAIAVETEVSFPEAEAIKDRLANPDAYAAAAPVAAAGGAAEETKAEKAPEPEEE
SDDDMGFGLFD