Protein Info for mRNA_3833 in Rhodosporidium toruloides IFO0880

Name: 12201
Annotation: K15196 BRF1, GTF3B transcription factor IIIB 90 kDa subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 PF08271: TF_Zn_Ribbon" amino acids 1 to 42 (42 residues), 32.7 bits, see alignment 6.3e-12 PF00382: TFIIB" amino acids 90 to 156 (67 residues), 52.5 bits, see alignment E=6.4e-18 amino acids 184 to 257 (74 residues), 62.6 bits, see alignment E=4.3e-21 PF07741: BRF1" amino acids 469 to 564 (96 residues), 93.8 bits, see alignment E=1.1e-30

Best Hits

Predicted SEED Role

"Transcription initiation factor IIIB 70 kDa subunit" in subsystem RNA polymerase III initiation factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (678 amino acids)

>mRNA_3833 K15196 BRF1, GTF3B transcription factor IIIB 90 kDa subunit (Rhodosporidium toruloides IFO0880)
MICTSCGEDSVLEMTEHAQTVCTRCGTVLSENAIVSEIQFGETGSGAAMVQGSYVGADQT
RARAPGGFRQRGVQSQESREQTLANGRRRIMELATGLRLSEHLQNVATRFFNLAVNMSFT
KGRRTQYVAAACLYAACRQANGTQMLIDFSDLLEINVFVLGSTYLKLVRQLNINIPVVDP
VIYITRFAALLDFGEETQKVALDATRLVNRMGRDWMQIGRRPSGICGACLLLAARMNNFR
RSIEEVVQVVKIADVTLRKRLAEFKETASGNLTVSDFRSIWLEETHDPPAYAVGLKKEED
ARKEQARKMREDSIAASETDSVVGDRAFRELAEREATADAEDDIASSSPVRERARGKENE
VEVEGAMLPPPKPSAKALGKRKRVEPEEEEGGAPSSDAASEREDVAEELLEGDGHEQYDA
VIEGELQNYLGSNVGVKLSHELESQEQKRRAKISQSPAYELDTNDSLEGLDEEELDAFIC
TEEEVQIKAKLWMEHNKEYLKELAEKQTGPDGELKPINKRPRKKTKPRDGANPTGLTAAD
ATTKMLEKKKFSKKINYDAIKNLFASGDSDAGSTYGGDDDEADTPLIGQTYGRKGSRVGT
PIVTPEPTWRQGSRAPSEAPSVGGRSALGREVANARHDDEGDEEDHEPEQREEDDEGWRS
QFATQAEGDDEEFGYDEV